PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00115286001
Common NameGSBRNA2T00115286001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 424aa    MW: 46906.7 Da    PI: 7.0187
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00115286001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.2e-32223278156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  GSBRNA2T00115286001 223 KARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 278
                          68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.682220280IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-28221281IPR009057Homeodomain-like
SuperFamilySSF466892.97E-17221281IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-26223278IPR006447Myb domain, plants
PfamPF002493.5E-7225276IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MASSSELSLD CKPQSYSMLL KSFGENFQSD QTTQKLEDLL SRLEQERLKI DAFKRELPLC  60
MQLLNNAVEV YKQQLEAYRA NNNNQSVVTR PVLEEFIPLR NQPEKANNWM TTAQLWSQPE  120
TKPKSIDQTT DQSPKDELAS SPKLGHVDAK QRNGGGAFHP FSKEQHLPEL ALSTEVKRFS  180
PTNEHPNDHG NDESIINSGK NNNNNINSNS NGVSSTTSQS NRKARRCWSP DLHRRFVQAL  240
QMLGGSQVAT PKQIRELMKV DGLTNDEVKS HLQKYRLHTR RPSPSPQTSG GQGPHLVVLG  300
GIWVPPEYTT AHGGTPTLYH HQVHHHHGNA ATQPPQHFCS SQEFYTTPPT PQPLHHQHFQ  360
TFNGSSAGGA TSNDSAHHQL TDSATDEGKS LESGGGEGKG LAALREEGED QSNINGSEIT  420
LKF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00115286001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2216620.0AK221662.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL09-70-E23.
GenBankAY0605590.0AY060559.1 Arabidopsis thaliana At2g03500/T4M8.7 mRNA, complete cds.
GenBankAY1336300.0AY133630.1 Arabidopsis thaliana At2g03500/T4M8.7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013594032.10.0PREDICTED: uncharacterized protein LOC106302066
TrEMBLA0A078ETU50.0A0A078ETU5_BRANA; BnaC07g22390D protein
TrEMBLA0A0D3DAN00.0A0A0D3DAN0_BRAOL; Uncharacterized protein
STRINGBra025115.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM71342843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.10.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]